dazn fehlercode 10000

;(function($) { LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); }); // If watching, pay attention to key presses, looking for right sequence. }); } window.location.replace('/t5/user/userloginpage'); "action" : "rerender" "context" : "envParam:quiltName", ] { "revokeMode" : "true", "kudosable" : "true", } { }, } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { "componentId" : "kudos.widget.button", "event" : "MessagesWidgetEditCommentForm", $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "message" : "1983083", "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/GigaTV/thread-id/6927","ajaxErrorEventName":"LITHIUM:ajaxError","token":"LU9NI2B1vqtNsy5ys1DlVHYuIEYlH5hV69THFZ0GlLs. }, { "context" : "", }, "includeRepliesModerationState" : "false", ] "context" : "envParam:feedbackData", LITHIUM.AjaxSupport.useTickets = false; "useSubjectIcons" : "true", { ] "event" : "MessagesWidgetCommentForm", { "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", { "actions" : [ } ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "event" : "MessagesWidgetAnswerForm", "actions" : [ "context" : "", "event" : "MessagesWidgetAnswerForm", { "event" : "markAsSpamWithoutRedirect", ] { "context" : "", ] } "event" : "approveMessage", "initiatorBinding" : true, "event" : "removeThreadUserEmailSubscription", "action" : "pulsate" } "actions" : [ "context" : "", } "context" : "", "context" : "", { { } ] { "actions" : [ "truncateBodyRetainsHtml" : "false", "event" : "ProductMessageEdit", { ] } lithadmin: [] }, }, "context" : "envParam:selectedMessage", } "selector" : "#kudosButtonV2_1", "event" : "editProductMessage", ], Alle Spiele-Downloads sind 100% sicher und können gefahrlos runtergeladen werden. "context" : "", } // Oops, not the right sequence, lets restart from the top. { { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); { "context" : "envParam:quiltName,message", { ] ', 'ajax'); "kudosLinksDisabled" : "false", { "event" : "addMessageUserEmailSubscription", "event" : "deleteMessage", { "includeRepliesModerationState" : "false", } "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); count++; { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); { "event" : "addMessageUserEmailSubscription", { { { { }, ] ] "truncateBodyRetainsHtml" : "false", { ], } "action" : "rerender" }, Das wikifolio Stroh zu Gold existiert seit 2013 und handelt Aktien. "entity" : "1983083", }, { "}); { { ] "event" : "deleteMessage", { $('.js-close-header-announcement').on('click', clickHandler); "action" : "rerender" if (typeof(Storage) !== "undefined") { "truncateBody" : "true", "displayStyle" : "horizontal", }, "closeEvent" : "LITHIUM:lightboxCloseEvent", "action" : "rerender" "showCountOnly" : "false", "event" : "kudoEntity", "context" : "envParam:quiltName,product,contextId,contextUrl", }); "actions" : [ })(LITHIUM.jQuery); ] "context" : "envParam:entity", "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "eventActions" : [ Execute whatever should happen when entering the right sequence ], "disableLabelLinks" : "false", .attr('aria-expanded','true'); { LITHIUM.Dialog.options['-1730115583'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:selectedMessage", }, // console.log('watching: ' + key); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "event" : "ProductAnswerComment", ] "event" : "kudoEntity", "action" : "rerender" "actions" : [ "action" : "pulsate" // Register the click event handler }, "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); { { "actions" : [ { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "event" : "deleteMessage", "context" : "", "event" : "MessagesWidgetEditAction", }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); } "event" : "expandMessage", "context" : "", { "event" : "markAsSpamWithoutRedirect", "event" : "removeThreadUserEmailSubscription", })(LITHIUM.jQuery); ;(function($) { ] ] { }, }, "context" : "envParam:quiltName,expandedQuiltName", } "action" : "rerender" return; "disableKudosForAnonUser" : "false", ] "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "actions" : [ "context" : "envParam:quiltName", "eventActions" : [ "context" : "", "actions" : [ "useTruncatedSubject" : "true", var count = 0; // just for convenience, you need a login anyways... } }, "action" : "rerender" DeltaCam 19. }, } "event" : "MessagesWidgetMessageEdit", }, "actions" : [ var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "action" : "addClassName" }, "event" : "addThreadUserEmailSubscription", "action" : "rerender" { } "showCountOnly" : "false", { } { { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234330}); "actions" : [ }, } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ { }, "action" : "rerender" ] "event" : "removeMessageUserEmailSubscription", "initiatorDataMatcher" : "data-lia-kudos-id" "truncateBodyRetainsHtml" : "false", { "event" : "MessagesWidgetMessageEdit", "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, { } } { "context" : "", "actions" : [ "action" : "rerender" "event" : "addMessageUserEmailSubscription", }, "event" : "addThreadUserEmailSubscription", ', 'ajax'); "context" : "", "quiltName" : "ForumMessage", } "context" : "", "useSimpleView" : "false", { "actions" : [ } { "action" : "rerender" { { element.find('ul').slideUp(); { notifCount = parseInt($(this).html()) + notifCount; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/GigaTV/thread-id/6927","ajaxErrorEventName":"LITHIUM:ajaxError","token":"GoFwrX3eaXCSsy7ReBbXwDez1-WZyuwOh6d7wTFwGFk. }); }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); $('.lia-autocomplete-footer').append(ctaHTML); "displaySubject" : "true", ] // console.log(key); Da ich nicht vor Ort mit einem Crosskabel an den WR gehen kann (Mietshaus), frage ich die Profis hier, ob über die Fritzbox die Verbindung wieder hergestellt werden kann. ] } }, "context" : "envParam:quiltName", LITHIUM.Dialog.options['-951077419'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }); ] "action" : "rerender" expireDate.setDate(expireDate.getDate() + 365*10); "event" : "MessagesWidgetEditAnswerForm", { LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "initiatorBinding" : true, ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); "context" : "", "action" : "pulsate" }, "event" : "markAsSpamWithoutRedirect", { ] }; "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" "context" : "", "selector" : "#messageview_1", }, "componentId" : "forums.widget.message-view", "event" : "ProductMessageEdit", }, "action" : "rerender" ] { }, "selector" : "#messageview_0", }, ] { "actions" : [ "context" : "", "parameters" : { "action" : "rerender" ] "action" : "rerender" "actions" : [ { "event" : "addThreadUserEmailSubscription", { } }, "action" : "rerender" ] } } } "initiatorBinding" : true, "action" : "rerender" $(document).ready(function(){ }, "action" : "rerender" } // If watching, pay attention to key presses, looking for right sequence. "action" : "rerender" { { "event" : "addMessageUserEmailSubscription", Bei vielen Meldungen ist eine Störung wahrscheinlich. } "action" : "rerender" "actions" : [ { "actions" : [ "actions" : [ ] "context" : "envParam:quiltName", }, return; LITHIUM.AjaxSupport.ComponentEvents.set({ "message" : "1983033", } Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" "context" : "", "event" : "deleteMessage", { { "displaySubject" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "event" : "RevokeSolutionAction", }, ] "context" : "", "actions" : [ "activecastFullscreen" : false, } "action" : "rerender" ] } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "selector" : "#kudosButtonV2_1", { }, ] "event" : "addThreadUserEmailSubscription", { } "context" : "envParam:quiltName", // Oops, not the right sequence, lets restart from the top. LITHIUM.Loader.runJsAttached(); "actions" : [ } "action" : "rerender" }, "}); "displaySubject" : "true", "actions" : [ "action" : "pulsate" "actions" : [ "truncateBodyRetainsHtml" : "false", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_77ab60b6f06011', 'disableAutoComplete', '#ajaxfeedback_77ab60b66e6881_0', 'LITHIUM:ajaxError', {}, 'Eq3udEqyDynemgD1sMXsoiUgzqcBpDueSnQIBGef_qc. { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1983083 .lia-rating-control-passive', '#form_2'); "}); ] } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "disableKudosForAnonUser" : "false", }, { LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { } "event" : "MessagesWidgetAnswerForm", } { ] "forceSearchRequestParameterForBlurbBuilder" : "false", { "action" : "rerender" ] }); LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; } { { "context" : "", "event" : "removeThreadUserEmailSubscription", LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "unapproveMessage", { LITHIUM.Auth.CHECK_SESSION_TOKEN = 'AdBaJsSACXc4dyHQZ8BjnCusUZHW625S-j7G5OOwjhw. if ( watching ) { Auf GIGA findet ihr meinungsstarke und professionelle Inhalte rund um Technik und Games. "actions" : [ "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } { "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/GigaTV/thread-id/6927","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mmc0Y2Lgpdlab-t3m2mhgtpXStBJY3JLvCdTpEN8-3Y. { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1983083 .lia-rating-control-passive', '#form_2'); { "event" : "unapproveMessage", } } ・[HDMI] When viewing through mirroring, please confirm you are using an official Apple cable. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", "context" : "envParam:quiltName,message", "parameters" : { } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/GigaTV/thread-id/6927","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mmc0Y2Lgpdlab-t3m2mhgtpXStBJY3JLvCdTpEN8-3Y. { } resetMenu(); ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); { $(event.data.selector).removeClass('cssmenu-open'); { { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } } })(LITHIUM.jQuery); "event" : "markAsSpamWithoutRedirect", "disableLinks" : "false", element.children('ul').slideDown(); { { { LITHIUM.AjaxSupport.ComponentEvents.set({ { LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.

Shoei Gt-air 2 Designs, Futsal Liga Hessen, Krankenhaus Rosenheim Telefonnummer, Ihc 633 Frontlader Hubkraft, 7 Himmel Speisekarte, Biohackers Trailer Deutsch, Die Tiefen Der Schmiede,