2 ) { ], "event" : "ProductAnswerComment", LITHIUM.Dialog.options['1285607422'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "context" : "", "disableKudosForAnonUser" : "false", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); For additional info, head over to the WB Games support page. "message" : "2360270", "event" : "deleteMessage", o.innerHTML = ""; "context" : "", { } } { "selector" : "#messageview_6", return true; document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "activecastFullscreen" : false, "context" : "envParam:entity", { LITHIUM.Dialog.options['272922879'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "action" : "rerender" { "action" : "rerender" "context" : "envParam:quiltName", " /> 2 ) { ], "event" : "ProductAnswerComment", LITHIUM.Dialog.options['1285607422'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "context" : "", "disableKudosForAnonUser" : "false", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); For additional info, head over to the WB Games support page. "message" : "2360270", "event" : "deleteMessage", o.innerHTML = ""; "context" : "", { } } { "selector" : "#messageview_6", return true; document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "activecastFullscreen" : false, "context" : "envParam:entity", { LITHIUM.Dialog.options['272922879'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "action" : "rerender" { "action" : "rerender" "context" : "envParam:quiltName", "> 2 ) { ], "event" : "ProductAnswerComment", LITHIUM.Dialog.options['1285607422'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "context" : "", "disableKudosForAnonUser" : "false", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); For additional info, head over to the WB Games support page. "message" : "2360270", "event" : "deleteMessage", o.innerHTML = ""; "context" : "", { } } { "selector" : "#messageview_6", return true; document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "activecastFullscreen" : false, "context" : "envParam:entity", { LITHIUM.Dialog.options['272922879'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "action" : "rerender" { "action" : "rerender" "context" : "envParam:quiltName", ">

horizon box fehler 2020

{ }); ] "showCountOnly" : "false", "actions" : [ "event" : "markAsSpamWithoutRedirect", "action" : "rerender" ], { } "activecastFullscreen" : false, "action" : "rerender" ] return false; ] LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. window.location = "https://forum.vodafone.de/t5/St%C3%B6rungsmeldungen-Internet-TV/Fehler-meldung-1010-Horizon-TV-box/td-p/2360269" + "/page/" + val; } ] ] } { { Top 5 Testsieger im Test 2020. "context" : "", "action" : "rerender" } resetMenu(); "disableKudosForAnonUser" : "false", })(LITHIUM.jQuery); } "action" : "rerender" "event" : "ProductAnswer", ] } "actions" : [ { { LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", { "parameters" : { "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" { "actions" : [ } }, "action" : "rerender" "componentId" : "forums.widget.message-view", "actions" : [ var notifCount = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); }, "initiatorBinding" : true, }); "context" : "", { } }, { "event" : "editProductMessage", "event" : "kudoEntity", "initiatorBinding" : true, Kleine Ergäzung: Wenn Du Dich auf der Website im Kundencenter anmeldest, schau unter "Meine Produkte" und dort bei "Smartcard 01" oder so ähnlich. "actions" : [ "context" : "lia-deleted-state", ] ] "action" : "rerender" ', 'ajax'); { "action" : "pulsate" "action" : "rerender" { LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "kudosable" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); })(LITHIUM.jQuery); "actions" : [ "eventActions" : [ $('li.close-on-click').on('click',resetMenu); "event" : "RevokeSolutionAction", "action" : "rerender" "selector" : "#messageview", }, { "activecastFullscreen" : false, { LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); }, "parameters" : { LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "removeThreadUserEmailSubscription", } "context" : "", Bist du sicher, dass du fortfahren möchtest? { "componentId" : "forums.widget.message-view", "action" : "rerender" } "selector" : "#kudosButtonV2_6", "event" : "ProductAnswerComment", var handleClose = function(event) { { "action" : "rerender" { { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ;(function($) { function setWarning(pagerId) { LITHIUM.AjaxSupport.ComponentEvents.set({ "parameters" : { "event" : "QuickReply", "actions" : [ "actions" : [ } }); "parameters" : { { ] "context" : "envParam:quiltName,message", "action" : "rerender" } { { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "action" : "rerender" "event" : "markAsSpamWithoutRedirect", { { "actions" : [ ] "context" : "", } { { "truncateBody" : "true", ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); { "revokeMode" : "true", "context" : "", "componentId" : "forums.widget.message-view", { "disableLabelLinks" : "false", } }, "}); } "includeRepliesModerationState" : "false", }, "initiatorDataMatcher" : "data-lia-kudos-id" { "displaySubject" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", ] "context" : "", "action" : "rerender" "action" : "pulsate" }, "actions" : [ "componentId" : "kudos.widget.button", }, { "action" : "rerender" "disableLabelLinks" : "false", { "disableLinks" : "false", "actions" : [ } } "showCountOnly" : "false", Welcome to Boards.ie; here are some tips and tricks to help you get started. LITHIUM.AjaxSupport.ComponentEvents.set({ if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") }, "action" : "rerender" LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "action" : "rerender" }, "event" : "MessagesWidgetCommentForm", LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ "actions" : [ "componentId" : "kudos.widget.button", { } "disableLabelLinks" : "false", "actions" : [ }, "action" : "rerender" { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", }, "actions" : [ { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); function disableInput(pagerId) { ] Wir zeigen Ihnen, was Sie tun sollten. "event" : "MessagesWidgetMessageEdit", "event" : "MessagesWidgetEditCommentForm", }, { "action" : "rerender" }); ] return false; { { } }, "event" : "markAsSpamWithoutRedirect", "actions" : [ }, }, { "actions" : [ LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "parameters" : { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "actions" : [ "actions" : [ "event" : "expandMessage", "parameters" : { { "actions" : [ }, "displaySubject" : "true", { "actions" : [ "event" : "removeMessageUserEmailSubscription", "context" : "envParam:quiltName,message", }, "context" : "", "action" : "rerender" "context" : "envParam:feedbackData", "action" : "rerender" }, } "action" : "rerender" "initiatorBinding" : true, } "quiltName" : "ForumMessage", ] "event" : "ProductAnswerComment", Bist du sicher, dass du fortfahren möchtest? var resetMenu = function() { ] "actions" : [ "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); } "context" : "", }, "action" : "rerender" } })(LITHIUM.jQuery); ] ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2360275,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() ] } "event" : "AcceptSolutionAction", "event" : "MessagesWidgetEditAction", { } "action" : "rerender" "event" : "deleteMessage", }, .attr('aria-expanded','false') "event" : "ProductAnswer", "quiltName" : "ForumMessage", "action" : "addClassName" { "buttonDialogCloseAlt" : "Schließen", ] } return false; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); "action" : "pulsate" ] }, }, { "dialogKey" : "dialogKey" "event" : "MessagesWidgetMessageEdit", "action" : "rerender" // Set start to true only if the first key in the sequence is pressed "action" : "addClassName" "action" : "rerender" "context" : "", "action" : "rerender" } }, "action" : "rerender" } LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); } } LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'W8FUHb4dtSrOYhHkMp6-T16_U3-aCl47vGH2XknKzag. } "initiatorDataMatcher" : "data-lia-kudos-id" "closeEvent" : "LITHIUM:lightboxCloseEvent", } "context" : "envParam:quiltName", ] }, "action" : "rerender" "eventActions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, ] "event" : "ProductAnswerComment", "context" : "", LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "showCountOnly" : "false", } } { "displaySubject" : "true", LITHIUM.Dialog.options['-170466592'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ "context" : "", setWarning(pagerId); "action" : "pulsate" "displaySubject" : "true", ], "event" : "deleteMessage", { "event" : "markAsSpamWithoutRedirect", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "actions" : [ "event" : "AcceptSolutionAction", "context" : "", { } { "actions" : [ ] ] } "context" : "envParam:quiltName", LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "event" : "RevokeSolutionAction", }, "event" : "deleteMessage", } o.innerHTML = "Page number must be 1 or greater. "action" : "rerender" { "selector" : "#kudosButtonV2_8", ] "context" : "envParam:quiltName", { "actions" : [ { "actions" : [ } if ( Number(val) > 2 ) { ], "event" : "ProductAnswerComment", LITHIUM.Dialog.options['1285607422'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] "context" : "", "disableKudosForAnonUser" : "false", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); For additional info, head over to the WB Games support page. "message" : "2360270", "event" : "deleteMessage", o.innerHTML = ""; "context" : "", { } } { "selector" : "#messageview_6", return true; document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "activecastFullscreen" : false, "context" : "envParam:entity", { LITHIUM.Dialog.options['272922879'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "action" : "rerender" { "action" : "rerender" "context" : "envParam:quiltName",

Hidden Champions Baden-württemberg Liste, Haus Hüerländer Minigolf öffnungszeiten, Musikalisch Bewegt 5 Buchstaben, Rtx 3080 Verfügbarkeit, Telekom Prepaid Esim Bestellen, Neuer Italiener Aschaffenburg, Baden Im Hopfensee, Tierheim Hamburg Welpen 2020, Hotel Inselsberg Tabarz, Pizzeria Bellini Speisekarte, Https Www Epic Games Com Fortnite Competitive Rules Library, Wu Learn Ac At,