a').on('click', function(){ { ], Die gesetzliche Widerrufsfrist von 14 Tagen. ] ] "actions" : [ { ] { ] "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "disableLinks" : "false", "action" : "rerender" var watching = false; LITHIUM.Loader.runJsAttached(); } "showCountOnly" : "false", { ] "context" : "envParam:entity", }, LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); ;(function($) { "kudosable" : "true", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2075990 .lia-rating-control-passive', '#form'); "event" : "expandMessage", { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); ] { "useTruncatedSubject" : "true", }, }, { // If watching, pay attention to key presses, looking for right sequence. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "MessagesWidgetEditAnswerForm", } { "context" : "envParam:quiltName", $('.css-menu').removeClass('cssmenu-open') count++; }, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.AjaxSupport.ComponentEvents.set({ if ( count == neededkeys.length ) { "initiatorDataMatcher" : "data-lia-message-uid" "event" : "MessagesWidgetEditAnswerForm", ] else { "context" : "envParam:quiltName", "context" : "", "context" : "envParam:entity", ] ] "action" : "rerender" "componentId" : "kudos.widget.button", { "forceSearchRequestParameterForBlurbBuilder" : "false", "closeEvent" : "LITHIUM:lightboxCloseEvent", LITHIUM.Dialog.options['2024863303'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "useSubjectIcons" : "true", }, "event" : "approveMessage", ] } "initiatorBinding" : true, "actions" : [ }, { Widerruf SEPA Mandat. }, "context" : "", watching = false; "event" : "MessagesWidgetEditAction", { "actions" : [ "event" : "ProductMessageEdit", "actions" : [ LITHIUM.Dialog({ ;(function($) { // Oops. }, "initiatorBinding" : true, { "actions" : [ "action" : "rerender" $(document).keydown(function(e) { ] } ] }, } }, { "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); ] { { "action" : "pulsate" LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useCountToKudo" : "false", Aufmachen, Aufkleber rausholen, wieder zukleben, Sticker drauf, ab auffe Post. Habe das Fax mit dem Widerruf an die Kundenhotline von Vodafone gesendet mit der Bitte um Rückbestätigung per Email. ] "event" : "expandMessage", window.location.replace('/t5/user/userloginpage'); "action" : "rerender" Geprüftes Widerrufsschreiben, ... dass bei Änderungen an Betreff oder Widerrufstext weiterhin nach dem Sinngehalt ein Widerruf vorliegt, ... Ich bitte um eine schriftliche Bestätigung. if ( key == neededkeys[0] ) { { "action" : "pulsate" einige Tage dauern. "context" : "", { ;(function($) { }, { "eventActions" : [ $(document).ready(function(){ LITHIUM.AjaxSupport.useTickets = false; { count = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); ] "action" : "rerender" "actions" : [ ] }, { "actions" : [ "selector" : "#kudosButtonV2_3", "event" : "editProductMessage", "event" : "expandMessage", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "action" : "rerender" LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; Re: Telefonische Vertragsverlängerung - besprochen... Betreff: Retoure abgelehnt wegen Gebrauchtspuren. "disableLabelLinks" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", count++; { } "context" : "", "actions" : [ "action" : "rerender" "disableLabelLinks" : "false", { "action" : "rerender" "context" : "", "event" : "removeThreadUserEmailSubscription", "context" : "envParam:selectedMessage", "event" : "MessagesWidgetCommentForm", "context" : "", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } ] "eventActions" : [ })(LITHIUM.jQuery); } } if ( !watching ) { { "kudosLinksDisabled" : "false", } { } logmein: [76, 79, 71, 77, 69, 73, 78], LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2077214 .lia-rating-control-passive', '#form_3'); ] "action" : "rerender" "truncateBodyRetainsHtml" : "false", "event" : "editProductMessage", "action" : "rerender" "truncateBodyRetainsHtml" : "false", "eventActions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "closeEvent" : "LITHIUM:lightboxCloseEvent", ] "event" : "kudoEntity", "displaySubject" : "true", "context" : "lia-deleted-state", $(document).ready(function(){ ] "useSubjectIcons" : "true", { "actions" : [ "actions" : [ LITHIUM.Auth.CHECK_SESSION_TOKEN = '9tpxAI_NzkMkSS5reb3qsoYKNj9n5PSjoqQxT5MEWFM. }; }); ] "action" : "pulsate" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-T0iCkpNr2YLKMb0Hk4PD38fYf0EXl0SsXl7hWc4ECA. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "componentId" : "kudos.widget.button", "eventActions" : [ "action" : "rerender" { "event" : "MessagesWidgetAnswerForm", { "eventActions" : [ { "event" : "kudoEntity", "actions" : [ ;(function($) { ] LITHIUM.AjaxSupport.ComponentEvents.set({ .attr('aria-expanded','false') "}); { "actions" : [ // console.log('watching: ' + key); "linkDisabled" : "false" Das bedeutet, dass du sowohl per Brief und Fax, als auch per E-Mail kündigen kannst. ] "componentId" : "kudos.widget.button", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; ] "initiatorBinding" : true, { "messageViewOptions" : "1111110111111111111110111110100101001101" ], "}); "parameters" : { { LITHIUM.AjaxSupport.useTickets = false; "actions" : [ "context" : "envParam:selectedMessage", { "actions" : [ resetMenu(); "event" : "MessagesWidgetEditAction", "disallowZeroCount" : "false", "event" : "removeThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); { $('div[class*="-menu-btn"]').removeClass('active'); "context" : "", } "context" : "envParam:quiltName,message", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2076467,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ;(function($) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" if ( watching ) { LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); { ] { "parameters" : { { LITHIUM.Dialog({ "context" : "envParam:feedbackData", { "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ { } }, } { "event" : "MessagesWidgetEditAction", }else{ "event" : "RevokeSolutionAction", } "event" : "approveMessage", "context" : "lia-deleted-state", }, "quiltName" : "ForumMessage", count = 0; ] Bist du sicher, dass du fortfahren möchtest? } { ] "action" : "pulsate" } "event" : "approveMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Tlgbg-Cl6G1pZMlnNcc96UThPcBN2ugbUsYIhYcoFwo. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); }, } ] "action" : "rerender" "event" : "ProductAnswer", // Reset the conditions so that someone can do it all again. ] ] { }, }, "event" : "ProductAnswer", Der Verbraucher muss seinen Entschluss zu widerrufen dem Unternehmer schriftlich und eindeutig formulieren. { "action" : "rerender" "event" : "RevokeSolutionAction", { "actions" : [ element.removeClass('active'); { { if ( key == neededkeys[0] ) { "actions" : [ "event" : "MessagesWidgetAnswerForm", { LITHIUM.AjaxSupport.ComponentEvents.set({ }, "event" : "ProductAnswerComment", "actions" : [ "action" : "rerender" { ], }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2076165,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); resetMenu(); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "kudosable" : "true", "componentId" : "forums.widget.message-view", { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); // --> LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); Welcher Mobilfunk-Vertragstyp macht rechtlich am wenigsten Ärger? LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); ] { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "actions" : [ { "forceSearchRequestParameterForBlurbBuilder" : "false", }, { ] { LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); Execute whatever should happen when entering the right sequence { "event" : "markAsSpamWithoutRedirect", { "event" : "QuickReply", }, } { "linkDisabled" : "false" } Betreff: Widerruf beauftragt, noch keine Bestätigung - wie lange dauert das? Execute whatever should happen when entering the right sequence "selector" : "#messageview_3", } "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", // Oops. "event" : "MessagesWidgetEditCommentForm", "context" : "", } else { "actions" : [ "event" : "MessagesWidgetAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); } { { }, "truncateBodyRetainsHtml" : "false", { { }, ] "useSimpleView" : "false", element.siblings('li').find('ul').slideUp(); "event" : "expandMessage", "actions" : [ { { "entity" : "2075990", "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "addMessageUserEmailSubscription", "action" : "addClassName" "kudosLinksDisabled" : "false", { } "actions" : [ lithadmin: [] ;(function($) { { Vielen Dank und herzlichen Gruß . "useSimpleView" : "false", } { }, LITHIUM.Loader.runJsAttached(); } LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; }, return; ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iBZoymCwAs-_Sl24rqnYN3W63kWRQ_VWFkbwZDOkF60. count = 0; "action" : "rerender" "actions" : [ ] "displaySubject" : "true", "action" : "rerender" watching = false; }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"W8HG_ShH22NPI-NfxL6oDtviTlPcRdwnfDs6GABvHjE. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "kudosable" : "true", "actions" : [ "disableLabelLinks" : "false", "actions" : [ "action" : "pulsate" element.addClass('active'); Willkommen im MeinKabel-Kundenportal - Nutze als Kunde das Online Hilfe- und Service-Angebot von Vodafone Kabel Deutschland Vodafone kümmert sich zuverlässig und zeitnah um Deine Anfragen. ], }); { }, ] "actions" : [ // --> Checke jetzt die gigaschnellen Internet- und Telefon-Angebote für zuhause und unterwegs von Vodafone und surf mit GigaSpeed über Kabel, DSL oder LTE. LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, '4FW-V4pshbjqjNU1JZ_lODptyuGHBdnCJB8nhpbTSoE. ;(function($){ "event" : "AcceptSolutionAction", "linkDisabled" : "false" "actions" : [ "event" : "ProductAnswerComment", }, "action" : "pulsate" "actions" : [ { }, "action" : "addClassName" "actions" : [ } "context" : "", }, { "disableLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); ] "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } "context" : "envParam:quiltName,message", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] } { "action" : "rerender" $(document).ready(function(){ "actions" : [ "action" : "rerender" "truncateBodyRetainsHtml" : "false", ] if ( watching ) { }); "initiatorBinding" : true, "componentId" : "kudos.widget.button", "action" : "rerender" "event" : "MessagesWidgetEditAction", }, } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); // enable redirect to login page when "logmein" is typed into the void =) }, LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_1eda7073bb4843","tooltipContentSelector":"#link_1eda7073bb4843_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_1eda7073bb4843_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); // --> $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] ] }); "context" : "envParam:quiltName,message,product,contextId,contextUrl", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2077214,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "disableLinks" : "false", "action" : "addClassName" // Register the click event handler "event" : "MessagesWidgetEditAnswerForm", "truncateBodyRetainsHtml" : "false", Die Community hilft!#bleibtgesund, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_1eda7073ee3221', 'disableAutoComplete', '#ajaxfeedback_1eda7073bb4843_0', 'LITHIUM:ajaxError', {}, 'Tey3-GMFPAGm7ul68A9XzhXz0X540o_dFQoGfw9I8nI. "context" : "", "kudosLinksDisabled" : "false", }, { } "context" : "", In der Widerrufsbelehrung deines Vertrages steht, an wen du dich wenden musst. "entity" : "2076319", var do_scroll = sessionStorage.is_scroll; ;(function($) { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2076165,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "displaySubject" : "true", "truncateBody" : "true", Vielen Dank im Voraus! }, ] "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_1eda7073bb4843","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_1eda7073bb4843_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/2001/thread-id/227579&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"XYhEys9KfKWN8IesAue2lmQf1wUzStZzCinsJll8KkI. "context" : "", } } "linkDisabled" : "false" "action" : "rerender" $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "context" : "", }, " /> a').on('click', function(){ { ], Die gesetzliche Widerrufsfrist von 14 Tagen. ] ] "actions" : [ { ] { ] "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "disableLinks" : "false", "action" : "rerender" var watching = false; LITHIUM.Loader.runJsAttached(); } "showCountOnly" : "false", { ] "context" : "envParam:entity", }, LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); ;(function($) { "kudosable" : "true", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2075990 .lia-rating-control-passive', '#form'); "event" : "expandMessage", { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); ] { "useTruncatedSubject" : "true", }, }, { // If watching, pay attention to key presses, looking for right sequence. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "MessagesWidgetEditAnswerForm", } { "context" : "envParam:quiltName", $('.css-menu').removeClass('cssmenu-open') count++; }, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.AjaxSupport.ComponentEvents.set({ if ( count == neededkeys.length ) { "initiatorDataMatcher" : "data-lia-message-uid" "event" : "MessagesWidgetEditAnswerForm", ] else { "context" : "envParam:quiltName", "context" : "", "context" : "envParam:entity", ] ] "action" : "rerender" "componentId" : "kudos.widget.button", { "forceSearchRequestParameterForBlurbBuilder" : "false", "closeEvent" : "LITHIUM:lightboxCloseEvent", LITHIUM.Dialog.options['2024863303'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "useSubjectIcons" : "true", }, "event" : "approveMessage", ] } "initiatorBinding" : true, "actions" : [ }, { Widerruf SEPA Mandat. }, "context" : "", watching = false; "event" : "MessagesWidgetEditAction", { "actions" : [ "event" : "ProductMessageEdit", "actions" : [ LITHIUM.Dialog({ ;(function($) { // Oops. }, "initiatorBinding" : true, { "actions" : [ "action" : "rerender" $(document).keydown(function(e) { ] } ] }, } }, { "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); ] { { "action" : "pulsate" LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useCountToKudo" : "false", Aufmachen, Aufkleber rausholen, wieder zukleben, Sticker drauf, ab auffe Post. Habe das Fax mit dem Widerruf an die Kundenhotline von Vodafone gesendet mit der Bitte um Rückbestätigung per Email. ] "event" : "expandMessage", window.location.replace('/t5/user/userloginpage'); "action" : "rerender" Geprüftes Widerrufsschreiben, ... dass bei Änderungen an Betreff oder Widerrufstext weiterhin nach dem Sinngehalt ein Widerruf vorliegt, ... Ich bitte um eine schriftliche Bestätigung. if ( key == neededkeys[0] ) { { "action" : "pulsate" einige Tage dauern. "context" : "", { ;(function($) { }, { "eventActions" : [ $(document).ready(function(){ LITHIUM.AjaxSupport.useTickets = false; { count = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); ] "action" : "rerender" "actions" : [ ] }, { "actions" : [ "selector" : "#kudosButtonV2_3", "event" : "editProductMessage", "event" : "expandMessage", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "action" : "rerender" LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; Re: Telefonische Vertragsverlängerung - besprochen... Betreff: Retoure abgelehnt wegen Gebrauchtspuren. "disableLabelLinks" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", count++; { } "context" : "", "actions" : [ "action" : "rerender" "disableLabelLinks" : "false", { "action" : "rerender" "context" : "", "event" : "removeThreadUserEmailSubscription", "context" : "envParam:selectedMessage", "event" : "MessagesWidgetCommentForm", "context" : "", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } ] "eventActions" : [ })(LITHIUM.jQuery); } } if ( !watching ) { { "kudosLinksDisabled" : "false", } { } logmein: [76, 79, 71, 77, 69, 73, 78], LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2077214 .lia-rating-control-passive', '#form_3'); ] "action" : "rerender" "truncateBodyRetainsHtml" : "false", "event" : "editProductMessage", "action" : "rerender" "truncateBodyRetainsHtml" : "false", "eventActions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "closeEvent" : "LITHIUM:lightboxCloseEvent", ] "event" : "kudoEntity", "displaySubject" : "true", "context" : "lia-deleted-state", $(document).ready(function(){ ] "useSubjectIcons" : "true", { "actions" : [ "actions" : [ LITHIUM.Auth.CHECK_SESSION_TOKEN = '9tpxAI_NzkMkSS5reb3qsoYKNj9n5PSjoqQxT5MEWFM. }; }); ] "action" : "pulsate" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-T0iCkpNr2YLKMb0Hk4PD38fYf0EXl0SsXl7hWc4ECA. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "componentId" : "kudos.widget.button", "eventActions" : [ "action" : "rerender" { "event" : "MessagesWidgetAnswerForm", { "eventActions" : [ { "event" : "kudoEntity", "actions" : [ ;(function($) { ] LITHIUM.AjaxSupport.ComponentEvents.set({ .attr('aria-expanded','false') "}); { "actions" : [ // console.log('watching: ' + key); "linkDisabled" : "false" Das bedeutet, dass du sowohl per Brief und Fax, als auch per E-Mail kündigen kannst. ] "componentId" : "kudos.widget.button", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; ] "initiatorBinding" : true, { "messageViewOptions" : "1111110111111111111110111110100101001101" ], "}); "parameters" : { { LITHIUM.AjaxSupport.useTickets = false; "actions" : [ "context" : "envParam:selectedMessage", { "actions" : [ resetMenu(); "event" : "MessagesWidgetEditAction", "disallowZeroCount" : "false", "event" : "removeThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); { $('div[class*="-menu-btn"]').removeClass('active'); "context" : "", } "context" : "envParam:quiltName,message", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2076467,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ;(function($) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" if ( watching ) { LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); { ] { "parameters" : { { LITHIUM.Dialog({ "context" : "envParam:feedbackData", { "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ { } }, } { "event" : "MessagesWidgetEditAction", }else{ "event" : "RevokeSolutionAction", } "event" : "approveMessage", "context" : "lia-deleted-state", }, "quiltName" : "ForumMessage", count = 0; ] Bist du sicher, dass du fortfahren möchtest? } { ] "action" : "pulsate" } "event" : "approveMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Tlgbg-Cl6G1pZMlnNcc96UThPcBN2ugbUsYIhYcoFwo. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); }, } ] "action" : "rerender" "event" : "ProductAnswer", // Reset the conditions so that someone can do it all again. ] ] { }, }, "event" : "ProductAnswer", Der Verbraucher muss seinen Entschluss zu widerrufen dem Unternehmer schriftlich und eindeutig formulieren. { "action" : "rerender" "event" : "RevokeSolutionAction", { "actions" : [ element.removeClass('active'); { { if ( key == neededkeys[0] ) { "actions" : [ "event" : "MessagesWidgetAnswerForm", { LITHIUM.AjaxSupport.ComponentEvents.set({ }, "event" : "ProductAnswerComment", "actions" : [ "action" : "rerender" { ], }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2076165,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); resetMenu(); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "kudosable" : "true", "componentId" : "forums.widget.message-view", { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); // --> LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); Welcher Mobilfunk-Vertragstyp macht rechtlich am wenigsten Ärger? LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); ] { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "actions" : [ { "forceSearchRequestParameterForBlurbBuilder" : "false", }, { ] { LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); Execute whatever should happen when entering the right sequence { "event" : "markAsSpamWithoutRedirect", { "event" : "QuickReply", }, } { "linkDisabled" : "false" } Betreff: Widerruf beauftragt, noch keine Bestätigung - wie lange dauert das? Execute whatever should happen when entering the right sequence "selector" : "#messageview_3", } "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", // Oops. "event" : "MessagesWidgetEditCommentForm", "context" : "", } else { "actions" : [ "event" : "MessagesWidgetAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); } { { }, "truncateBodyRetainsHtml" : "false", { { }, ] "useSimpleView" : "false", element.siblings('li').find('ul').slideUp(); "event" : "expandMessage", "actions" : [ { { "entity" : "2075990", "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "addMessageUserEmailSubscription", "action" : "addClassName" "kudosLinksDisabled" : "false", { } "actions" : [ lithadmin: [] ;(function($) { { Vielen Dank und herzlichen Gruß . "useSimpleView" : "false", } { }, LITHIUM.Loader.runJsAttached(); } LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; }, return; ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iBZoymCwAs-_Sl24rqnYN3W63kWRQ_VWFkbwZDOkF60. count = 0; "action" : "rerender" "actions" : [ ] "displaySubject" : "true", "action" : "rerender" watching = false; }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"W8HG_ShH22NPI-NfxL6oDtviTlPcRdwnfDs6GABvHjE. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "kudosable" : "true", "actions" : [ "disableLabelLinks" : "false", "actions" : [ "action" : "pulsate" element.addClass('active'); Willkommen im MeinKabel-Kundenportal - Nutze als Kunde das Online Hilfe- und Service-Angebot von Vodafone Kabel Deutschland Vodafone kümmert sich zuverlässig und zeitnah um Deine Anfragen. ], }); { }, ] "actions" : [ // --> Checke jetzt die gigaschnellen Internet- und Telefon-Angebote für zuhause und unterwegs von Vodafone und surf mit GigaSpeed über Kabel, DSL oder LTE. LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, '4FW-V4pshbjqjNU1JZ_lODptyuGHBdnCJB8nhpbTSoE. ;(function($){ "event" : "AcceptSolutionAction", "linkDisabled" : "false" "actions" : [ "event" : "ProductAnswerComment", }, "action" : "pulsate" "actions" : [ { }, "action" : "addClassName" "actions" : [ } "context" : "", }, { "disableLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); ] "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } "context" : "envParam:quiltName,message", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] } { "action" : "rerender" $(document).ready(function(){ "actions" : [ "action" : "rerender" "truncateBodyRetainsHtml" : "false", ] if ( watching ) { }); "initiatorBinding" : true, "componentId" : "kudos.widget.button", "action" : "rerender" "event" : "MessagesWidgetEditAction", }, } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); // enable redirect to login page when "logmein" is typed into the void =) }, LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_1eda7073bb4843","tooltipContentSelector":"#link_1eda7073bb4843_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_1eda7073bb4843_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); // --> $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] ] }); "context" : "envParam:quiltName,message,product,contextId,contextUrl", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2077214,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "disableLinks" : "false", "action" : "addClassName" // Register the click event handler "event" : "MessagesWidgetEditAnswerForm", "truncateBodyRetainsHtml" : "false", Die Community hilft!#bleibtgesund, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_1eda7073ee3221', 'disableAutoComplete', '#ajaxfeedback_1eda7073bb4843_0', 'LITHIUM:ajaxError', {}, 'Tey3-GMFPAGm7ul68A9XzhXz0X540o_dFQoGfw9I8nI. "context" : "", "kudosLinksDisabled" : "false", }, { } "context" : "", In der Widerrufsbelehrung deines Vertrages steht, an wen du dich wenden musst. "entity" : "2076319", var do_scroll = sessionStorage.is_scroll; ;(function($) { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2076165,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "displaySubject" : "true", "truncateBody" : "true", Vielen Dank im Voraus! }, ] "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_1eda7073bb4843","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_1eda7073bb4843_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/2001/thread-id/227579&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"XYhEys9KfKWN8IesAue2lmQf1wUzStZzCinsJll8KkI. "context" : "", } } "linkDisabled" : "false" "action" : "rerender" $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "context" : "", }, "> a').on('click', function(){ { ], Die gesetzliche Widerrufsfrist von 14 Tagen. ] ] "actions" : [ { ] { ] "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "disableLinks" : "false", "action" : "rerender" var watching = false; LITHIUM.Loader.runJsAttached(); } "showCountOnly" : "false", { ] "context" : "envParam:entity", }, LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); ;(function($) { "kudosable" : "true", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2075990 .lia-rating-control-passive', '#form'); "event" : "expandMessage", { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); ] { "useTruncatedSubject" : "true", }, }, { // If watching, pay attention to key presses, looking for right sequence. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "MessagesWidgetEditAnswerForm", } { "context" : "envParam:quiltName", $('.css-menu').removeClass('cssmenu-open') count++; }, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.AjaxSupport.ComponentEvents.set({ if ( count == neededkeys.length ) { "initiatorDataMatcher" : "data-lia-message-uid" "event" : "MessagesWidgetEditAnswerForm", ] else { "context" : "envParam:quiltName", "context" : "", "context" : "envParam:entity", ] ] "action" : "rerender" "componentId" : "kudos.widget.button", { "forceSearchRequestParameterForBlurbBuilder" : "false", "closeEvent" : "LITHIUM:lightboxCloseEvent", LITHIUM.Dialog.options['2024863303'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "useSubjectIcons" : "true", }, "event" : "approveMessage", ] } "initiatorBinding" : true, "actions" : [ }, { Widerruf SEPA Mandat. }, "context" : "", watching = false; "event" : "MessagesWidgetEditAction", { "actions" : [ "event" : "ProductMessageEdit", "actions" : [ LITHIUM.Dialog({ ;(function($) { // Oops. }, "initiatorBinding" : true, { "actions" : [ "action" : "rerender" $(document).keydown(function(e) { ] } ] }, } }, { "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); ] { { "action" : "pulsate" LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useCountToKudo" : "false", Aufmachen, Aufkleber rausholen, wieder zukleben, Sticker drauf, ab auffe Post. Habe das Fax mit dem Widerruf an die Kundenhotline von Vodafone gesendet mit der Bitte um Rückbestätigung per Email. ] "event" : "expandMessage", window.location.replace('/t5/user/userloginpage'); "action" : "rerender" Geprüftes Widerrufsschreiben, ... dass bei Änderungen an Betreff oder Widerrufstext weiterhin nach dem Sinngehalt ein Widerruf vorliegt, ... Ich bitte um eine schriftliche Bestätigung. if ( key == neededkeys[0] ) { { "action" : "pulsate" einige Tage dauern. "context" : "", { ;(function($) { }, { "eventActions" : [ $(document).ready(function(){ LITHIUM.AjaxSupport.useTickets = false; { count = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); ] "action" : "rerender" "actions" : [ ] }, { "actions" : [ "selector" : "#kudosButtonV2_3", "event" : "editProductMessage", "event" : "expandMessage", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "action" : "rerender" LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; Re: Telefonische Vertragsverlängerung - besprochen... Betreff: Retoure abgelehnt wegen Gebrauchtspuren. "disableLabelLinks" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", count++; { } "context" : "", "actions" : [ "action" : "rerender" "disableLabelLinks" : "false", { "action" : "rerender" "context" : "", "event" : "removeThreadUserEmailSubscription", "context" : "envParam:selectedMessage", "event" : "MessagesWidgetCommentForm", "context" : "", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } ] "eventActions" : [ })(LITHIUM.jQuery); } } if ( !watching ) { { "kudosLinksDisabled" : "false", } { } logmein: [76, 79, 71, 77, 69, 73, 78], LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2077214 .lia-rating-control-passive', '#form_3'); ] "action" : "rerender" "truncateBodyRetainsHtml" : "false", "event" : "editProductMessage", "action" : "rerender" "truncateBodyRetainsHtml" : "false", "eventActions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "closeEvent" : "LITHIUM:lightboxCloseEvent", ] "event" : "kudoEntity", "displaySubject" : "true", "context" : "lia-deleted-state", $(document).ready(function(){ ] "useSubjectIcons" : "true", { "actions" : [ "actions" : [ LITHIUM.Auth.CHECK_SESSION_TOKEN = '9tpxAI_NzkMkSS5reb3qsoYKNj9n5PSjoqQxT5MEWFM. }; }); ] "action" : "pulsate" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-T0iCkpNr2YLKMb0Hk4PD38fYf0EXl0SsXl7hWc4ECA. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "componentId" : "kudos.widget.button", "eventActions" : [ "action" : "rerender" { "event" : "MessagesWidgetAnswerForm", { "eventActions" : [ { "event" : "kudoEntity", "actions" : [ ;(function($) { ] LITHIUM.AjaxSupport.ComponentEvents.set({ .attr('aria-expanded','false') "}); { "actions" : [ // console.log('watching: ' + key); "linkDisabled" : "false" Das bedeutet, dass du sowohl per Brief und Fax, als auch per E-Mail kündigen kannst. ] "componentId" : "kudos.widget.button", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; ] "initiatorBinding" : true, { "messageViewOptions" : "1111110111111111111110111110100101001101" ], "}); "parameters" : { { LITHIUM.AjaxSupport.useTickets = false; "actions" : [ "context" : "envParam:selectedMessage", { "actions" : [ resetMenu(); "event" : "MessagesWidgetEditAction", "disallowZeroCount" : "false", "event" : "removeThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); { $('div[class*="-menu-btn"]').removeClass('active'); "context" : "", } "context" : "envParam:quiltName,message", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2076467,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ;(function($) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" if ( watching ) { LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); { ] { "parameters" : { { LITHIUM.Dialog({ "context" : "envParam:feedbackData", { "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ { } }, } { "event" : "MessagesWidgetEditAction", }else{ "event" : "RevokeSolutionAction", } "event" : "approveMessage", "context" : "lia-deleted-state", }, "quiltName" : "ForumMessage", count = 0; ] Bist du sicher, dass du fortfahren möchtest? } { ] "action" : "pulsate" } "event" : "approveMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Tlgbg-Cl6G1pZMlnNcc96UThPcBN2ugbUsYIhYcoFwo. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); }, } ] "action" : "rerender" "event" : "ProductAnswer", // Reset the conditions so that someone can do it all again. ] ] { }, }, "event" : "ProductAnswer", Der Verbraucher muss seinen Entschluss zu widerrufen dem Unternehmer schriftlich und eindeutig formulieren. { "action" : "rerender" "event" : "RevokeSolutionAction", { "actions" : [ element.removeClass('active'); { { if ( key == neededkeys[0] ) { "actions" : [ "event" : "MessagesWidgetAnswerForm", { LITHIUM.AjaxSupport.ComponentEvents.set({ }, "event" : "ProductAnswerComment", "actions" : [ "action" : "rerender" { ], }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2076165,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); resetMenu(); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "kudosable" : "true", "componentId" : "forums.widget.message-view", { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); // --> LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); Welcher Mobilfunk-Vertragstyp macht rechtlich am wenigsten Ärger? LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); ] { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "actions" : [ { "forceSearchRequestParameterForBlurbBuilder" : "false", }, { ] { LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); Execute whatever should happen when entering the right sequence { "event" : "markAsSpamWithoutRedirect", { "event" : "QuickReply", }, } { "linkDisabled" : "false" } Betreff: Widerruf beauftragt, noch keine Bestätigung - wie lange dauert das? Execute whatever should happen when entering the right sequence "selector" : "#messageview_3", } "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", // Oops. "event" : "MessagesWidgetEditCommentForm", "context" : "", } else { "actions" : [ "event" : "MessagesWidgetAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); } { { }, "truncateBodyRetainsHtml" : "false", { { }, ] "useSimpleView" : "false", element.siblings('li').find('ul').slideUp(); "event" : "expandMessage", "actions" : [ { { "entity" : "2075990", "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "addMessageUserEmailSubscription", "action" : "addClassName" "kudosLinksDisabled" : "false", { } "actions" : [ lithadmin: [] ;(function($) { { Vielen Dank und herzlichen Gruß . "useSimpleView" : "false", } { }, LITHIUM.Loader.runJsAttached(); } LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; }, return; ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iBZoymCwAs-_Sl24rqnYN3W63kWRQ_VWFkbwZDOkF60. count = 0; "action" : "rerender" "actions" : [ ] "displaySubject" : "true", "action" : "rerender" watching = false; }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"W8HG_ShH22NPI-NfxL6oDtviTlPcRdwnfDs6GABvHjE. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "kudosable" : "true", "actions" : [ "disableLabelLinks" : "false", "actions" : [ "action" : "pulsate" element.addClass('active'); Willkommen im MeinKabel-Kundenportal - Nutze als Kunde das Online Hilfe- und Service-Angebot von Vodafone Kabel Deutschland Vodafone kümmert sich zuverlässig und zeitnah um Deine Anfragen. ], }); { }, ] "actions" : [ // --> Checke jetzt die gigaschnellen Internet- und Telefon-Angebote für zuhause und unterwegs von Vodafone und surf mit GigaSpeed über Kabel, DSL oder LTE. LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, '4FW-V4pshbjqjNU1JZ_lODptyuGHBdnCJB8nhpbTSoE. ;(function($){ "event" : "AcceptSolutionAction", "linkDisabled" : "false" "actions" : [ "event" : "ProductAnswerComment", }, "action" : "pulsate" "actions" : [ { }, "action" : "addClassName" "actions" : [ } "context" : "", }, { "disableLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); ] "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } "context" : "envParam:quiltName,message", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] } { "action" : "rerender" $(document).ready(function(){ "actions" : [ "action" : "rerender" "truncateBodyRetainsHtml" : "false", ] if ( watching ) { }); "initiatorBinding" : true, "componentId" : "kudos.widget.button", "action" : "rerender" "event" : "MessagesWidgetEditAction", }, } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); // enable redirect to login page when "logmein" is typed into the void =) }, LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_1eda7073bb4843","tooltipContentSelector":"#link_1eda7073bb4843_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_1eda7073bb4843_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); // --> $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] ] }); "context" : "envParam:quiltName,message,product,contextId,contextUrl", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2077214,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "disableLinks" : "false", "action" : "addClassName" // Register the click event handler "event" : "MessagesWidgetEditAnswerForm", "truncateBodyRetainsHtml" : "false", Die Community hilft!#bleibtgesund, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_1eda7073ee3221', 'disableAutoComplete', '#ajaxfeedback_1eda7073bb4843_0', 'LITHIUM:ajaxError', {}, 'Tey3-GMFPAGm7ul68A9XzhXz0X540o_dFQoGfw9I8nI. "context" : "", "kudosLinksDisabled" : "false", }, { } "context" : "", In der Widerrufsbelehrung deines Vertrages steht, an wen du dich wenden musst. "entity" : "2076319", var do_scroll = sessionStorage.is_scroll; ;(function($) { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2076165,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "displaySubject" : "true", "truncateBody" : "true", Vielen Dank im Voraus! }, ] "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_1eda7073bb4843","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_1eda7073bb4843_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/2001/thread-id/227579&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"XYhEys9KfKWN8IesAue2lmQf1wUzStZzCinsJll8KkI. "context" : "", } } "linkDisabled" : "false" "action" : "rerender" $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "context" : "", }, ">

vodafone widerruf bestätigung

{ LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); ] "initiatorBinding" : true, } }, ] }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2077214 .lia-rating-control-passive', '#form_3'); Bundesweit tätige Kanzlei für Verbraucherrecht. "actions" : [ "context" : "envParam:selectedMessage", "event" : "AcceptSolutionAction", } } ] "context" : "", { "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "context" : "", "actions" : [ "dialogContentCssClass" : "lia-panel-dialog-content", }, resetMenu(); createStorage("false"); "event" : "kudoEntity", }, { LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Tlgbg-Cl6G1pZMlnNcc96UThPcBN2ugbUsYIhYcoFwo. "displayStyle" : "horizontal", ] "context" : "", "quiltName" : "ForumMessage", expireDate.setDate(expireDate.getDate() + 365*10); "context" : "", "actions" : [ $('#node-menu li.has-sub>a').on('click', function(){ { ], Die gesetzliche Widerrufsfrist von 14 Tagen. ] ] "actions" : [ { ] { ] "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "disableLinks" : "false", "action" : "rerender" var watching = false; LITHIUM.Loader.runJsAttached(); } "showCountOnly" : "false", { ] "context" : "envParam:entity", }, LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); ;(function($) { "kudosable" : "true", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2075990 .lia-rating-control-passive', '#form'); "event" : "expandMessage", { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); ] { "useTruncatedSubject" : "true", }, }, { // If watching, pay attention to key presses, looking for right sequence. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "MessagesWidgetEditAnswerForm", } { "context" : "envParam:quiltName", $('.css-menu').removeClass('cssmenu-open') count++; }, ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.AjaxSupport.ComponentEvents.set({ if ( count == neededkeys.length ) { "initiatorDataMatcher" : "data-lia-message-uid" "event" : "MessagesWidgetEditAnswerForm", ] else { "context" : "envParam:quiltName", "context" : "", "context" : "envParam:entity", ] ] "action" : "rerender" "componentId" : "kudos.widget.button", { "forceSearchRequestParameterForBlurbBuilder" : "false", "closeEvent" : "LITHIUM:lightboxCloseEvent", LITHIUM.Dialog.options['2024863303'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "useSubjectIcons" : "true", }, "event" : "approveMessage", ] } "initiatorBinding" : true, "actions" : [ }, { Widerruf SEPA Mandat. }, "context" : "", watching = false; "event" : "MessagesWidgetEditAction", { "actions" : [ "event" : "ProductMessageEdit", "actions" : [ LITHIUM.Dialog({ ;(function($) { // Oops. }, "initiatorBinding" : true, { "actions" : [ "action" : "rerender" $(document).keydown(function(e) { ] } ] }, } }, { "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); ] { { "action" : "pulsate" LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useCountToKudo" : "false", Aufmachen, Aufkleber rausholen, wieder zukleben, Sticker drauf, ab auffe Post. Habe das Fax mit dem Widerruf an die Kundenhotline von Vodafone gesendet mit der Bitte um Rückbestätigung per Email. ] "event" : "expandMessage", window.location.replace('/t5/user/userloginpage'); "action" : "rerender" Geprüftes Widerrufsschreiben, ... dass bei Änderungen an Betreff oder Widerrufstext weiterhin nach dem Sinngehalt ein Widerruf vorliegt, ... Ich bitte um eine schriftliche Bestätigung. if ( key == neededkeys[0] ) { { "action" : "pulsate" einige Tage dauern. "context" : "", { ;(function($) { }, { "eventActions" : [ $(document).ready(function(){ LITHIUM.AjaxSupport.useTickets = false; { count = 0; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); ] "action" : "rerender" "actions" : [ ] }, { "actions" : [ "selector" : "#kudosButtonV2_3", "event" : "editProductMessage", "event" : "expandMessage", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "action" : "rerender" LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; Re: Telefonische Vertragsverlängerung - besprochen... Betreff: Retoure abgelehnt wegen Gebrauchtspuren. "disableLabelLinks" : "false", "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", count++; { } "context" : "", "actions" : [ "action" : "rerender" "disableLabelLinks" : "false", { "action" : "rerender" "context" : "", "event" : "removeThreadUserEmailSubscription", "context" : "envParam:selectedMessage", "event" : "MessagesWidgetCommentForm", "context" : "", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } ] "eventActions" : [ })(LITHIUM.jQuery); } } if ( !watching ) { { "kudosLinksDisabled" : "false", } { } logmein: [76, 79, 71, 77, 69, 73, 78], LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2077214 .lia-rating-control-passive', '#form_3'); ] "action" : "rerender" "truncateBodyRetainsHtml" : "false", "event" : "editProductMessage", "action" : "rerender" "truncateBodyRetainsHtml" : "false", "eventActions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "closeEvent" : "LITHIUM:lightboxCloseEvent", ] "event" : "kudoEntity", "displaySubject" : "true", "context" : "lia-deleted-state", $(document).ready(function(){ ] "useSubjectIcons" : "true", { "actions" : [ "actions" : [ LITHIUM.Auth.CHECK_SESSION_TOKEN = '9tpxAI_NzkMkSS5reb3qsoYKNj9n5PSjoqQxT5MEWFM. }; }); ] "action" : "pulsate" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-T0iCkpNr2YLKMb0Hk4PD38fYf0EXl0SsXl7hWc4ECA. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); "componentId" : "kudos.widget.button", "eventActions" : [ "action" : "rerender" { "event" : "MessagesWidgetAnswerForm", { "eventActions" : [ { "event" : "kudoEntity", "actions" : [ ;(function($) { ] LITHIUM.AjaxSupport.ComponentEvents.set({ .attr('aria-expanded','false') "}); { "actions" : [ // console.log('watching: ' + key); "linkDisabled" : "false" Das bedeutet, dass du sowohl per Brief und Fax, als auch per E-Mail kündigen kannst. ] "componentId" : "kudos.widget.button", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; ] "initiatorBinding" : true, { "messageViewOptions" : "1111110111111111111110111110100101001101" ], "}); "parameters" : { { LITHIUM.AjaxSupport.useTickets = false; "actions" : [ "context" : "envParam:selectedMessage", { "actions" : [ resetMenu(); "event" : "MessagesWidgetEditAction", "disallowZeroCount" : "false", "event" : "removeThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); { $('div[class*="-menu-btn"]').removeClass('active'); "context" : "", } "context" : "envParam:quiltName,message", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2076467,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ;(function($) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" if ( watching ) { LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); { ] { "parameters" : { { LITHIUM.Dialog({ "context" : "envParam:feedbackData", { "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ { } }, } { "event" : "MessagesWidgetEditAction", }else{ "event" : "RevokeSolutionAction", } "event" : "approveMessage", "context" : "lia-deleted-state", }, "quiltName" : "ForumMessage", count = 0; ] Bist du sicher, dass du fortfahren möchtest? } { ] "action" : "pulsate" } "event" : "approveMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Tlgbg-Cl6G1pZMlnNcc96UThPcBN2ugbUsYIhYcoFwo. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); }, } ] "action" : "rerender" "event" : "ProductAnswer", // Reset the conditions so that someone can do it all again. ] ] { }, }, "event" : "ProductAnswer", Der Verbraucher muss seinen Entschluss zu widerrufen dem Unternehmer schriftlich und eindeutig formulieren. { "action" : "rerender" "event" : "RevokeSolutionAction", { "actions" : [ element.removeClass('active'); { { if ( key == neededkeys[0] ) { "actions" : [ "event" : "MessagesWidgetAnswerForm", { LITHIUM.AjaxSupport.ComponentEvents.set({ }, "event" : "ProductAnswerComment", "actions" : [ "action" : "rerender" { ], }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2076165,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "action" : "rerender" { LITHIUM.AjaxSupport.ComponentEvents.set({ $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); resetMenu(); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "kudosable" : "true", "componentId" : "forums.widget.message-view", { ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); // --> LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); Welcher Mobilfunk-Vertragstyp macht rechtlich am wenigsten Ärger? LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); ] { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "actions" : [ { "forceSearchRequestParameterForBlurbBuilder" : "false", }, { ] { LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); Execute whatever should happen when entering the right sequence { "event" : "markAsSpamWithoutRedirect", { "event" : "QuickReply", }, } { "linkDisabled" : "false" } Betreff: Widerruf beauftragt, noch keine Bestätigung - wie lange dauert das? Execute whatever should happen when entering the right sequence "selector" : "#messageview_3", } "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", // Oops. "event" : "MessagesWidgetEditCommentForm", "context" : "", } else { "actions" : [ "event" : "MessagesWidgetAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); } { { }, "truncateBodyRetainsHtml" : "false", { { }, ] "useSimpleView" : "false", element.siblings('li').find('ul').slideUp(); "event" : "expandMessage", "actions" : [ { { "entity" : "2075990", "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "addMessageUserEmailSubscription", "action" : "addClassName" "kudosLinksDisabled" : "false", { } "actions" : [ lithadmin: [] ;(function($) { { Vielen Dank und herzlichen Gruß . "useSimpleView" : "false", } { }, LITHIUM.Loader.runJsAttached(); } LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; }, return; ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iBZoymCwAs-_Sl24rqnYN3W63kWRQ_VWFkbwZDOkF60. count = 0; "action" : "rerender" "actions" : [ ] "displaySubject" : "true", "action" : "rerender" watching = false; }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/2001/thread-id/227579","ajaxErrorEventName":"LITHIUM:ajaxError","token":"W8HG_ShH22NPI-NfxL6oDtviTlPcRdwnfDs6GABvHjE. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); "kudosable" : "true", "actions" : [ "disableLabelLinks" : "false", "actions" : [ "action" : "pulsate" element.addClass('active'); Willkommen im MeinKabel-Kundenportal - Nutze als Kunde das Online Hilfe- und Service-Angebot von Vodafone Kabel Deutschland Vodafone kümmert sich zuverlässig und zeitnah um Deine Anfragen. ], }); { }, ] "actions" : [ // --> Checke jetzt die gigaschnellen Internet- und Telefon-Angebote für zuhause und unterwegs von Vodafone und surf mit GigaSpeed über Kabel, DSL oder LTE. LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, '4FW-V4pshbjqjNU1JZ_lODptyuGHBdnCJB8nhpbTSoE. ;(function($){ "event" : "AcceptSolutionAction", "linkDisabled" : "false" "actions" : [ "event" : "ProductAnswerComment", }, "action" : "pulsate" "actions" : [ { }, "action" : "addClassName" "actions" : [ } "context" : "", }, { "disableLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); ] "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } "context" : "envParam:quiltName,message", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] } { "action" : "rerender" $(document).ready(function(){ "actions" : [ "action" : "rerender" "truncateBodyRetainsHtml" : "false", ] if ( watching ) { }); "initiatorBinding" : true, "componentId" : "kudos.widget.button", "action" : "rerender" "event" : "MessagesWidgetEditAction", }, } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); // enable redirect to login page when "logmein" is typed into the void =) }, LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_1eda7073bb4843","tooltipContentSelector":"#link_1eda7073bb4843_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_1eda7073bb4843_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); // --> $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] ] }); "context" : "envParam:quiltName,message,product,contextId,contextUrl", { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2077214,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "disableLinks" : "false", "action" : "addClassName" // Register the click event handler "event" : "MessagesWidgetEditAnswerForm", "truncateBodyRetainsHtml" : "false", Die Community hilft!#bleibtgesund, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_1eda7073ee3221', 'disableAutoComplete', '#ajaxfeedback_1eda7073bb4843_0', 'LITHIUM:ajaxError', {}, 'Tey3-GMFPAGm7ul68A9XzhXz0X540o_dFQoGfw9I8nI. "context" : "", "kudosLinksDisabled" : "false", }, { } "context" : "", In der Widerrufsbelehrung deines Vertrages steht, an wen du dich wenden musst. "entity" : "2076319", var do_scroll = sessionStorage.is_scroll; ;(function($) { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2076165,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "displaySubject" : "true", "truncateBody" : "true", Vielen Dank im Voraus! }, ] "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_1eda7073bb4843","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_1eda7073bb4843_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/2001/thread-id/227579&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"XYhEys9KfKWN8IesAue2lmQf1wUzStZzCinsJll8KkI. "context" : "", } } "linkDisabled" : "false" "action" : "rerender" $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "context" : "", },

Fluchthaus Weiden Mission Possible, Ciao Bella Hamburg Bergedorf, Indische Kartoffeln Mit Kichererbsen, El Toro Koblenz Speisekarte, Männer Style 2020 Herbst, Dachstein Skigebiet Corona, Nespresso Kapseln Media Markt, Schloss Favorite - Eremitage,